Host taxon 9606
Protein NP_115753.1
transcription elongation factor 1 homolog isoform 1
Homo sapiens
Gene ELOF1, UniProt P60002
>NP_115753.1|Haemophilus ducreyi 35000HP|transcription elongation factor 1 homolog isoform 1
MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.83 | 0.829792818492114 | 6.9e-5 | 31213562 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)