Host taxon 9606
Protein NP_703154.1
transcription cofactor vestigial-like protein 2 isoform 2
Homo sapiens
Gene VGLL2, UniProt Q8N8G2
>NP_703154.1|Haemophilus ducreyi 35000HP|transcription cofactor vestigial-like protein 2 isoform 2
MSCLDVMYQVYGPPQPYFAAAYTPYHQKLAYYSKMQEAQECNASPSSSGSGSSSFSSQTPASIKEEEGSPEKERPPEAEYINSRCVLFTYFQGDISSVVDEHFSRALSQPSSYSPSCTSSKAPRSSGPWRARRYSLCGASLLS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.78 | -1.77688955752197 | 0.024 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)