Host taxon 9606
Protein NP_758955.2
trafficking regulator of GLUT4 1
Homo sapiens
Gene TRARG1, UniProt Q8IXB3
>NP_758955.2|Haemophilus ducreyi 35000HP|trafficking regulator of GLUT4 1
MAHPVQSEFPSAQEPGSAAFLDLPEMEILLTKAENKDDKTLNLSKTLSGPLDLEQNSQGLPFKAISEGHLEAPLPRSPSRASSRRASSIATTSYAQDQEAPRDYLILAVVACFCPVWPLNLIPLIISIMSRSSMQQGNVDGARRLGRLARLLSITLIIMGIVIIMVAVTVNFTVQKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ -2.44 | -2.44287618567819 | 0.0034 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)