Host taxon 9606
Protein NP_001132916.1
trafficking protein particle complex subunit 3-like protein
Homo sapiens
Gene TRAPPC3L, UniProt Q5T215
>NP_001132916.1|Haemophilus ducreyi 35000HP|trafficking protein particle complex subunit 3-like protein
MSRPAHRRPEYHKINKDLFVLTYGALVAQLCKDYEKDEDVNQYLDKMGYGIGTRLVEDFLARSCVGRCHSYSEIIDIIAQVAFKMYLGITPSVTCNNSSKNEFSLILEKNPLVEFVEELPAGRSSLCYCNLLCGIIRGALEMVHLAADVTFLQDRLKGDSVTEIGITFLKKRDEKKYRGKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.64 | 1.63768217318573 | 0.0012 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)