Host taxon 9606
Protein NP_001257823.1
trafficking protein particle complex subunit 3 isoform 2
Homo sapiens
Gene TRAPPC3, UniProt O43617
>NP_001257823.1|Haemophilus ducreyi 35000HP|trafficking protein particle complex subunit 3 isoform 2
MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKILFSNFLPRGFNIGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.81 | 0.806343326364626 | 0.00044 | 31213562 | |
Retrieved 1 of 3 entries in 1.1 ms
(Link to these results)