Host taxon 9606
Protein NP_001160093.1
trafficking protein particle complex subunit 1
Homo sapiens
Gene TRAPPC1, UniProt Q9Y5R8
>NP_001160093.1|Haemophilus ducreyi 35000HP|trafficking protein particle complex subunit 1
MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFFSARAG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.38 | 1.38476517843947 | 6.9e-8 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)