Host taxon 9606
Protein NP_001092691.1
TRAF-interacting protein with FHA domain-containing protein B
Homo sapiens
Gene TIFAB, UniProt Q6ZNK6
>NP_001092691.1|Haemophilus ducreyi 35000HP|TRAF-interacting protein with FHA domain-containing protein B
MEKPLTVLRVSLYHPTLGPSAFANVPPRLQHDTSPLLLGRGQDAHLQLQLPRLSRRHLSLEPYLEKGSALLAFCLKALSRKGCVWVNGLTLRYLEQVPLSTVNRVSFSGIQMLVRVEEGTSLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQGQPPPGSG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.77 | 2.76595102101225 | 8.7e-6 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)