Host taxon 9606
Protein NP_443096.1
TRAF-interacting protein with FHA domain-containing protein A
Homo sapiens
Gene TIFA, UniProt Q96CG3
>NP_443096.1|Haemophilus ducreyi 35000HP|TRAF-interacting protein with FHA domain-containing protein A
MTSFEDADTEETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQFSLQLFKKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEKEDGESLEFFETQFILSPRSLLQENNWPPHRPIPEYGTYSLCSSQSSSPTEMDENES
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.23 | 1.23001337921615 | 0.0015 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)