Host taxon 9606
Protein NP_001291712.1
TLD domain-containing protein 2 isoform 2
Homo sapiens
Gene TLDC2, UniProt A0PJX2
>NP_001291712.1|Haemophilus ducreyi 35000HP|TLD domain-containing protein 2 isoform 2
MRGLRWRYTRLPSQVEDTLSGEEGNEEEEEEEAAPDPAAAPEDPTVPQLTEASQVLSASEIRQLSFHFPPRVTGHPWSLVFCTSRDGFSLQSLYRRMEGCSGPVLLVLRDQDGQVFKWTGSNSFFVKGDLDSLMMGSGSGRFGLWLDGDLFRGGSSPCPTFNNEVLARQEQFCIQELEAWLLS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.82 | 1.82054144175157 | 7.2e-8 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)