Host taxon 9606
Protein NP_003242.1
thyroid hormone-inducible hepatic protein
Homo sapiens
Gene THRSP, UniProt Q92748
>NP_003242.1|Haemophilus ducreyi 35000HP|thyroid hormone-inducible hepatic protein
MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ -2.77 | -2.76690963645792 | 0.00036 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)