Host taxon 9606
Protein NP_066932.1
thymosin beta-4
Homo sapiens
Gene TMSB4X, UniProt P62328
>NP_066932.1|Haemophilus ducreyi 35000HP|thymosin beta-4
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.46 | 2.46397777280701 | 1.2e-17 | 31213562 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)