Host taxon 9606
Protein NP_068832.1
thymosin beta-15A
Homo sapiens
Gene TMSB15A, UniProt P0CG34
>NP_068832.1|Haemophilus ducreyi 35000HP|thymosin beta-15A
MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.35 | 3.35326299428854 | 0.001 | 31213562 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)