Host taxon 9606
Protein NP_001298089.1
thy-1 membrane glycoprotein isoform 1 preproprotein
Homo sapiens
Gene THY1, UniProt P04216
>NP_001298089.1|Haemophilus ducreyi 35000HP|thy-1 membrane glycoprotein isoform 1 preproprotein
MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.34 | 2.34053166232077 | 3.1e-7 | 31213562 | |
Retrieved 1 of 2 entries in 0.4 ms
(Link to these results)