Host taxon 9606
Protein NP_001272333.1
THO complex subunit 7 homolog isoform 2
Homo sapiens
Gene THOC7, UniProt Q6I9Y2
>NP_001272333.1|Haemophilus ducreyi 35000HP|THO complex subunit 7 homolog isoform 2
MLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.52 | 0.523733817538004 | 0.029 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)