Host taxon 9606
Protein NP_057359.2
thioredoxin reductase-like selenoprotein T precursor
Homo sapiens
Gene SELENOT, UniProt P62341
>NP_057359.2|Haemophilus ducreyi 35000HP|thioredoxin reductase-like selenoprotein T precursor
MRLLLLLLVAASAMVRSEASANLGGVPSKRLKMQYATGPLLKFQICVSUGYRRVFEEYMRVISQRYPDIRIEGENYLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.88 | 0.878278060801699 | 3.2e-5 | 31213562 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)