Host taxon 9606
Protein NP_116120.1
thioredoxin domain-containing protein 17
Homo sapiens
Gene TXNDC17, UniProt Q9BRA2
>NP_116120.1|Haemophilus ducreyi 35000HP|thioredoxin domain-containing protein 17
MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.4 | 1.40430225527619 | 4.7e-6 | 31213562 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)