Host taxon 9606
Protein NP_056997.1
thioredoxin domain-containing protein 12 precursor
Homo sapiens
Gene TXNDC12, UniProt O95881
>NP_056997.1|Haemophilus ducreyi 35000HP|thioredoxin domain-containing protein 12 precursor
METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.26 | 1.25849848555541 | 8.7e-9 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)