Host taxon 9606
Protein NP_001265672.1
tetraspanin-6 isoform d precursor
Homo sapiens
Gene TSPAN6, UniProt O43657
>NP_001265672.1|Haemophilus ducreyi 35000HP|tetraspanin-6 isoform d precursor
MLKLYAMFLTLVFLVELVAAIVGFVFRHEIKNSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDADKVNNELIGIFLAYCLSRAITNNQYEIV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.69 | -0.688252234677228 | 0.019 | 31213562 | |
Retrieved 1 of 4 entries in 2.1 ms
(Link to these results)