Host taxon 9606
Protein NP_001316667.1
telomerase RNA component interacting RNase isoform 2
Homo sapiens
Gene TRIR, UniProt Q9BQ61
>NP_001316667.1|Haemophilus ducreyi 35000HP|telomerase RNA component interacting RNase isoform 2
MAARGRRAEPQGREAPGPAGGGGGGSRWAESGSGTSPESGDEEVSGAGSSPVSGGVNLFANDGSFLELFKRKMEEEQRQRQEEPPPGPQRPDQSAAAAGPGDPKRKGGPGSTLSFVLTSKGDAWAKYMAEVKKYKAHQCGDDDKTRPLVK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.06 | 1.06264385527352 | 0.0015 | 31213562 | |
Retrieved 1 of 3 entries in 1.3 ms
(Link to these results)