Host taxon 9606
Protein NP_001094090.1
tastin isoform 2
Homo sapiens
Gene TROAP, UniProt Q12815
>NP_001094090.1|Haemophilus ducreyi 35000HP|tastin isoform 2
MTTRQATKDPLLRGVSPTPSKIPVRSQKRTPFPTVTSCAVDQENQDPRRWVQKPPLNIQRPLVDSAGPRPKARHQAETSQRLVGISQPRNPLEELRPSPRGQNVGPGPPAQTVLVPAPGKLFALRRSPFPPAKCHLARCHGLYL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.4 | 1.39898755416251 | 3.0e-6 | 31213562 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)