Host taxon 9606
Protein NP_001070971.1
tachykinin-4 isoform beta precursor
Homo sapiens
Gene TAC4, UniProt Q86UU9
>NP_001070971.1|Haemophilus ducreyi 35000HP|tachykinin-4 isoform beta precursor
MLPCLALLLLMELSVCTVAGDGGEEQTLSTEAETWEGAGPSIQLQLQEVKTGKASQFFGLMGKRVGAYQLEHTFQGLLGKRSLFTEGREDEAQGSE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.59 | -0.594148304345181 | 0.032 | 31213562 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)