Host taxon 9606
Protein NP_001171525.1
tachykinin-3 isoform 2 precursor
Homo sapiens
Gene TAC3, UniProt Q9UHF0
>NP_001171525.1|Haemophilus ducreyi 35000HP|tachykinin-3 isoform 2 precursor
MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKHSPTDVNQENVPSFGILKYPPRAE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ -2.99 | -2.98944616284668 | 5.9e-5 | 31213562 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)