Host taxon 9606
Protein NP_001304676.1
T-cell receptor-associated transmembrane adapter 1 isoform 2
Homo sapiens
Gene TRAT1, UniProt Q6PIZ9
>NP_001304676.1|Haemophilus ducreyi 35000HP|T-cell receptor-associated transmembrane adapter 1 isoform 2
MSDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.16 | 2.1649456401586 | 6.8e-6 | 31213562 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)