Host taxon 9606
Protein NP_004909.1
T-cell leukemia/lymphoma protein 1B
Homo sapiens
Gene TCL1B, UniProt O95988
>NP_004909.1|Haemophilus ducreyi 35000HP|T-cell leukemia/lymphoma protein 1B
MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSITVHLWQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPERKD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.48 | 3.48251937563303 | 0.025 | 31213562 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)