Host taxon 9606
Protein NP_001002759.1
swi5-dependent recombination DNA repair protein 1 homolog isoform a
Homo sapiens
Gene SFR1, UniProt Q86XK3
>NP_001002759.1|Haemophilus ducreyi 35000HP|swi5-dependent recombination DNA repair protein 1 homolog isoform a
MAEGEKNQDFTFKMESPSDSAVVLPSTPQASANPSSPYTNSSRKQPMSATLRERLRKTRFSFNSSYNVVKRLKVESEENDQTFSEKPASSTEENCLEFQESFKHIDSEFEENTNLKNTLKNLNVCESQSLDSGSCSALQNEFVSEKLPKQRLNAEKAKLVKQVQEKEDLLRRLKLVKMYRSKNDLSQLQLLIKKWRSCSQLLLYELQSAVSEENKKLSLTQLIDHYGLDDKLLHYNRSEEEFIDV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.5 | 0.496992076335202 | 0.028 | 31213562 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)