Host taxon 9606
Protein NP_002991.2
succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial precursor
Homo sapiens
Gene SDHB, UniProt P21912
>NP_002991.2|Haemophilus ducreyi 35000HP|succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial precursor
MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.92 | 0.917093424544212 | 0.00059 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)