Bacterial taxon 233412
Protein WP_010944131.1
succinate dehydrogenase assembly factor 2
Haemophilus ducreyi 35000HP
Gene sdhE, UniProt Q7VPK3
>WP_010944131.1|Haemophilus ducreyi 35000HP|succinate dehydrogenase assembly factor 2
MAELNRFKIEWQCRRGMRELDKMIMPFYQQYFEQLSEAEQRTFVTMLSYTDPELFRWVMHQSPAPTVAISALIERIRASIEA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●●○○○ 1.03 | 1.02593696036374 | 0.018 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)