Host taxon 9606
Protein NP_001166947.1
striated muscle preferentially expressed protein kinase isoform 4
Homo sapiens
Gene SPEG, UniProt Q15772
>NP_001166947.1|Haemophilus ducreyi 35000HP|striated muscle preferentially expressed protein kinase isoform 4
MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.3 | -1.29544987684167 | 0.00011 | 31213562 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)