Host taxon 9606
Protein NP_001271168.1
store-operated calcium entry-associated regulatory factor isoform 2
Homo sapiens
Gene SARAF, UniProt Q96BY9
>NP_001271168.1|Haemophilus ducreyi 35000HP|store-operated calcium entry-associated regulatory factor isoform 2
MSGLITIVVLLGIAFVVYKLFLSDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.88 | 0.884052906189317 | 0.00015 | 31213562 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)