Host taxon 9606
Protein NP_001025231.1
sterile alpha motif domain-containing protein 5
Homo sapiens
Gene SAMD5, UniProt Q5TGI4
>NP_001025231.1|Haemophilus ducreyi 35000HP|sterile alpha motif domain-containing protein 5
MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRILEAVRRLREQDANAAGLYFTLEPQPAPPGPPADAVPTGRRGEPCGGPAQGTRGDSRGHTTAPRSRELVSYPKLKLKIMIRDKLVRDGIHLSKPPYSRKVPMAGILEYLMNWPKSSQSR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.33 | -1.33265643874598 | 0.00031 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)