Host taxon 9606
Protein NP_001010971.1
sterile alpha motif domain-containing protein 13 isoform 1
Homo sapiens
Gene SAMD13, UniProt Q5VXD3
>NP_001010971.1|Haemophilus ducreyi 35000HP|sterile alpha motif domain-containing protein 13 isoform 1
MRGVAEVKEPCSLPMLSVDMENKENGSVGVKNSMENGRPPDPADWAVMDVVNYFRTVGFEEQASAFQEQEIDGKSLLLMTRNDVLTGLQLKLGPALKIYEYHVKPLQTKHLKNNSS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.92 | -0.91903248784794 | 0.048 | 31213562 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)