Host taxon 9606
Protein NP_057389.1
SS18-like protein 2
Homo sapiens
Gene SS18L2, UniProt Q9UHA2
>NP_057389.1|Haemophilus ducreyi 35000HP|SS18-like protein 2
MSVAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLHRNLIYLATIADASPTSTSKAME
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.59 | 0.591810092563027 | 0.0029 | 31213562 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)