Host taxon 9606
Protein NP_001035515.1
splicing factor U2AF 26 kDa subunit isoform 1
Homo sapiens
Gene U2AF1L4, UniProt Q8WU68
>NP_001035515.1|Haemophilus ducreyi 35000HP|splicing factor U2AF 26 kDa subunit isoform 1
MAEYLASIFGTEKDKVNCSFYFKIGVCRHGDRCSRLHNKPTFSQEVFTELQEKYGEIEEMNVCDNLGDHLVGNVYVKFRREEDGERAVAELSNRWFNGQAVHGELSPVTDFRESCCRQYEMGECTRGGFCNFMHLRPISQNLQRQLYGRGPRRRSPPRFHTGHHPRERNHRCSPDHWHGRF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.18 | 1.18311211439771 | 5.5e-6 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)