Host taxon 9606
Protein NP_057131.1
splicing factor 3B subunit 6
Homo sapiens
Gene SF3B6, UniProt Q9Y3B4
>NP_057131.1|Haemophilus ducreyi 35000HP|splicing factor 3B subunit 6
MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.09 | 1.08849255406231 | 1.0e-5 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)