Host taxon 9606
Protein NP_112577.1
splicing factor 3B subunit 5
Homo sapiens
Gene SF3B5, UniProt Q9BWJ5
>NP_112577.1|Haemophilus ducreyi 35000HP|splicing factor 3B subunit 5
MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.17 | 1.16895724647476 | 3.1e-6 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)