Host taxon 9606
Protein NP_001094065.1
spindle and kinetochore-associated protein 2 isoform 2
Homo sapiens
Gene SKA2, UniProt Q8WVK7
>NP_001094065.1|Haemophilus ducreyi 35000HP|spindle and kinetochore-associated protein 2 isoform 2
MASEVGHNLESPETPGGGGWTRVEFPPPAPKGAATVWCLNRLGSRKLSLIWITFNTGWNMKSRLIILIQQVSCHH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.66 | 0.656146781214074 | 9.9e-6 | 31213562 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)