Host taxon 9606
Protein NP_001020607.1
sperm-associated antigen 16 protein isoform 2
Homo sapiens
Gene SPAG16, UniProt Q8N0X2
>NP_001020607.1|Haemophilus ducreyi 35000HP|sperm-associated antigen 16 protein isoform 2
MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.79 | -0.786750908526259 | 0.004 | 31213562 | |
Retrieved 1 of 2 entries in 2 ms
(Link to these results)