Host taxon 9606
Protein NP_001243117.1
sorting nexin-12 isoform 4
Homo sapiens
Gene SNX12, UniProt Q9UMY4
>NP_001243117.1|Haemophilus ducreyi 35000HP|sorting nexin-12 isoform 4
MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYETNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVRQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.28 | 0.283465077633536 | 0.038 | 31213562 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)