Host taxon 9606
Protein NP_694957.3
somatomedin-B and thrombospondin type-1 domain-containing protein precursor
Homo sapiens
Gene SBSPON, UniProt Q8IVN8
>NP_694957.3|Haemophilus ducreyi 35000HP|somatomedin-B and thrombospondin type-1 domain-containing protein precursor
MRTLWMALCALSRLWPGAQAGCAEAGRCCPGRDPACFARGWRLDRVYGTCFCDQACRFTGDCCFDYDRACPARPCFVGEWSPWSGCADQCKPTTRVRRRSVQQEPQNGGAPCPPLEERAGCLEYSTPQGQDCGHTYVPAFITTSAFNKERTRQATSPHWSTHTEDAGYCMEFKTESLTPHCALENWPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.83 | -0.825269765994975 | 0.02 | 31213562 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)