Host taxon 9606
Protein NP_690603.3
sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 isoform 1 precursor
Homo sapiens
Gene NKAIN4, UniProt Q8IVV8
>NP_690603.3|Haemophilus ducreyi 35000HP|sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 isoform 1 precursor
MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILGLFGTIQYRLRYVMVYTLWAAVWVTWNVFIICFYLEVGGLLKDSELLTFSLSRHRSWWRERWPGCLHEEVPAVGLGAPHGQALVSGAGCALEPSYVEALHSCLQILIALLGFVCGCQVVSVFTEEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQVYLPA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.62 | -1.62101754620957 | 0.017 | 31213562 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)