Host taxon 9606
Protein NP_004579.1
sodium channel subunit beta-2 precursor
Homo sapiens
Gene SCN2B, UniProt O60939
>NP_004579.1|Haemophilus ducreyi 35000HP|sodium channel subunit beta-2 precursor
MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.15 | -1.148900180191 | 0.013 | 31213562 | |
Retrieved 1 of 2 entries in 0.3 ms
(Link to these results)