Host taxon 9606
Protein NP_001287826.1
sodium channel and clathrin linker 1 isoform 2
Homo sapiens
Gene SCLT1, UniProt Q96NL6
>NP_001287826.1|Haemophilus ducreyi 35000HP|sodium channel and clathrin linker 1 isoform 2
MAAEIDFLREQNRRLNEDFRRYQMESFSKYSSVQKAVCQGEGDDTFENLVFDQSFLAPLVTEYDKHLGELNGQLKYYQA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.96 | 0.959961193397491 | 6.7e-6 | 31213562 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)