Host taxon 9606
Protein NP_036569.1
SNARE-associated protein Snapin
Homo sapiens
Gene SNAPIN, UniProt O95295
>NP_036569.1|Haemophilus ducreyi 35000HP|SNARE-associated protein Snapin
MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.87 | 0.871362654108926 | 0.00057 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)