Host taxon 9606
Protein NP_001307269.1
small VCP/p97-interacting protein isoform 1
Homo sapiens
Gene SVIP, UniProt Q8NHG7
>NP_001307269.1|Haemophilus ducreyi 35000HP|small VCP/p97-interacting protein isoform 1
MEFGAKRHCFLRELFSRLGDEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEGGLRWTVS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.6 | -0.600478335799854 | 0.00062 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)