Host taxon 9606
Protein NP_955374.1
small vasohibin-binding protein
Homo sapiens
Gene SVBP, UniProt Q8N300
>NP_955374.1|Haemophilus ducreyi 35000HP|small vasohibin-binding protein
MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.82 | 0.819459080724752 | 0.0082 | 31213562 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)