Host taxon 9606
Protein NP_001002255.1
small ubiquitin-related modifier 4
Homo sapiens
Gene SUMO4, UniProt Q6EEV6
>NP_001002255.1|Haemophilus ducreyi 35000HP|small ubiquitin-related modifier 4
MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.89 | 0.892011703549719 | 1.2e-5 | 31213562 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)