Host taxon 9606
Protein NP_001091058.1
small proline-rich protein 3
Homo sapiens
Gene SPRR3, UniProt Q9UBC9
>NP_001091058.1|Haemophilus ducreyi 35000HP|small proline-rich protein 3
MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 9.9 | 9.90141960911812 | 4.1e-16 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)