Host taxon 9606
Protein NP_001014450.1
small proline-rich protein 2F
Homo sapiens
Gene SPRR2F, UniProt Q96RM1
>NP_001014450.1|Haemophilus ducreyi 35000HP|small proline-rich protein 2F
MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPPQQCQQKCPPVTPSPPCQPKCPPKSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 8.22 | 8.21730449673481 | 8.7e-8 | 31213562 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)