Host taxon 9606
Protein NP_008876.3
small proline-rich protein 2D
Homo sapiens
Gene SPRR2D, UniProt P22532
>NP_008876.3|Haemophilus ducreyi 35000HP|small proline-rich protein 2D
MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPCQPKCPPKSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.44 | 4.43997337977756 | 3.8e-8 | 31213562 | |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)