Host taxon 9606
Protein NP_001017418.1
small proline-rich protein 2B
Homo sapiens
Gene SPRR2B, UniProt P35325
>NP_001017418.1|Haemophilus ducreyi 35000HP|small proline-rich protein 2B
MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 5.87 | 5.87039796680811 | 1.7e-5 | 31213562 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)